PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA26G00777
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family Dof
Protein Properties Length: 186aa    MW: 20096.3 Da    PI: 8.9174
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA26G00777genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-393393262
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                ++++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvP+Gg++rkn k+s
  AA26G00777 33 QQEQLKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPIGGASRKNSKRS 93
                6789*****************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-262384IPR003851Zinc finger, Dof-type
PfamPF027013.3E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0683791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEDPSSVAVA AAAASAYYYE TMMAKQQFPI PDQQEQLKCP RCDSPNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTKGGALRNV PIGGASRKNS KRSSGSSTTS SSSNKKTKNQ DPVPVLTTKP  120
ESSPNRVLYG FSMGEQDLKG IESGSFSSLL ASNMQLGLGV GGIFLNGSGW DSGLDLGNEG  180
GYEQSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0175648e-55AB017564.1 Arabidopsis thaliana adof1 mRNA for dof zinc finger protein, complete cds.
GenBankAC0252948e-55AC025294.14 Arabidopsis thaliana chromosome 1 BAC F19C24 genomic sequence, complete sequence.
GenBankAK2291068e-55AK229106.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-39-C17.
GenBankBT0257728e-55BT025772.1 Arabidopsis thaliana At1g51700 mRNA, complete cds.
GenBankCP0026848e-55CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406292.18e-71hypothetical protein EUTSA_v10021538mg
SwissprotQ94AR61e-62DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLV4LBD48e-71V4LBD4_EUTSA; Uncharacterized protein
STRINGscaffold_302540.12e-69(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.15e-52DOF zinc finger protein 2